PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26135.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Dof
Protein Properties Length: 315aa    MW: 34097.4 Da    PI: 7.8385
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26135.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.7e-393089261
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                             +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  mrna26135.1-v1.0-hybrid 30 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRS 89
                             57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-272483IPR003851Zinc finger, Dof-type
PfamPF027011.9E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5063488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MQDIQSSFGG RFFGGAGAGD RRLRPHHNQN HQALKCPRCD SLNTKFCYYN NYNLSQPRHF  60
CKSCRRYWTK GGVLRNVPVG GGCRKAKRSK PKSSSSSPAS PPQPNSERRA TSNSSSESSS  120
LTNTTATATE AVSAPSSTSS ASNLLNIPDS KFFVSQSGAN ASFETTTTAT MLEQSAATEI  180
GMFSDMVTFT SLITASNDVP FGFTNINNIS VPPFRVNQPG HQQQQVEQSQ WEQQQNSQEM  240
KLPELTGGML DQTTAQVDLS VFQTKANGGG GGFGSLDWQP AGDQGLFDLP NTVDHAYWSQ  300
GQWTDQDPPS LYIP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299274.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLM5WA031e-116M5WA03_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s03520.12e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-34OBF binding protein 4